PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G142100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 802aa    MW: 88814.5 Da    PI: 4.7363
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G142100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding231.9e-07650692145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         rg+W++ + + ++++ +q+G++ ++ I + ++  +t+ q++ ++ 
  Seita.1G142100.1.p 650 RGKWSKSDTDMFYKGLRQFGSD-FAMIQQLLP-DKTRHQVRAKFK 692
                         89********************.*********.********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.79E-10640698IPR009057Homeodomain-like
PfamPF159634.6E-24643721No hitNo description
Gene3DG3DSA:1.10.10.605.4E-5647696IPR009057Homeodomain-like
SMARTSM007174.2E-8649697IPR001005SANT/Myb domain
CDDcd001672.33E-5652693No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 802 aa     Download sequence    Send to blast
MIDDEANFDI LDASEEVQAA AKFRPKQRAK PRKTVLSSRS AASNPTVENG NGKLGVSNQV  60
SSSKELTSQE RASLTCPGSE TIDDVAGSQV ILETSSDDVL TVPLGPPGGT SAADRISQDD  120
KNNADSSKLA THKKILVVPD IQVSPASSCG KTIDDIVEFE ELFGAQDKEE RDAKFQPKVQ  180
TKLLKATKSQ KTNQKVEASP VDEATQKESR DNIQTRLHYD QLQDPKCHGS VQTPDSEGLL  240
ATSNNDIGNL ANLDSVLEVS VQEETIAKFR PKLRPKPAMV SSKVVGTNDN TTAATLMVGI  300
CAENNDVPTK PKDQETITAP ATWSPQDVDA TVDLDNHNEL INSPIDGTQS MVGEVSAEAT  360
CKSQPSVGRE KGKGKSVSFA MPDASGVVTP TVTNSEMDNV SDSYNDKLID ENLSNLSQQT  420
VQKNSNDQEH NEGEPLDPPV EQQPKSGVGE IGSSMKLRSR KKSQKVGTHK DTDDYFDEDF  480
VEPSLAEEDN DSGDDYTAGT TRKVRKKPRD SVEESLQQKV QKDKSQVSSR GRKRTLKDAS  540
AEKPEKKLTH RIRQSRAKEV KTLLEKPREE IDPMKLSAAH LRLLQEARER VNGKENPPEP  600
SSNSSSFQFD DMDDLDYRDE ERNFDNDRTQ NPAQNVTKLN YHSYMNKQTR GKWSKSDTDM  660
FYKGLRQFGS DFAMIQQLLP DKTRHQVRAK FKTEEKKNPL LVHDAIIHRS GDNLYFKTVI  720
KNLNIEDVAQ QEINNTRKQD GASSERGPGK ENVLDDFIHG EEDDSNWLDE EHSVQKPDVQ  780
EEEHASGNDD DGDLGDVFDW Y*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1502508KVRKKPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794595e-81HF679459.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB53 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698054.10.0PREDICTED: uncharacterized protein LOC101786485 isoform X1
RefseqXP_012698055.10.0PREDICTED: uncharacterized protein LOC101786485 isoform X1
RefseqXP_012698056.10.0PREDICTED: uncharacterized protein LOC101786485 isoform X1
TrEMBLA0A096U2U50.0A0A096U2U5_MAIZE; Uncharacterized protein
STRINGGRMZM2G573732_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25952946
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.14e-28MYB_related family protein